PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHN26857.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family MYB
Protein Properties Length: 386aa    MW: 43986.6 Da    PI: 4.5388
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHN26857.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding49.21.2e-151663148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     rg+W++ Ed++l+  ++++G ++W++ ++  g+ R++k+c++rw +yl
       KHN26857.1 16 RGPWSPAEDLKLIAFIQKYGHENWRALPKQAGLLRCGKSCRLRWINYL 63
                     89******************************99************97 PP

2Myb_DNA-binding52.41.2e-1669114148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg++T eE+e +++++k lG++ W++Ia++++ gRt++++k+ w+++l
       KHN26857.1  69 RGNFTLEEEENIIRLHKALGNK-WSKIASRLP-GRTDNEIKNVWNTHL 114
                      89********************.*********.************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.606.5E-24766IPR009057Homeodomain-like
PROSITE profilePS5129414.151163IPR017930Myb domain
SuperFamilySSF466892.2E-2914110IPR009057Homeodomain-like
SMARTSM007173.5E-131565IPR001005SANT/Myb domain
PfamPF002491.8E-141663IPR001005SANT/Myb domain
CDDcd001672.95E-91863No hitNo description
PROSITE profilePS5129425.4964118IPR017930Myb domain
Gene3DG3DSA:1.10.10.603.6E-2667118IPR009057Homeodomain-like
SMARTSM007175.1E-1568116IPR001005SANT/Myb domain
PfamPF002494.1E-1569114IPR001005SANT/Myb domain
CDDcd001675.49E-1071114No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009751Biological Processresponse to salicylic acid
GO:0009753Biological Processresponse to jasmonic acid
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:2000652Biological Processregulation of secondary cell wall biogenesis
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 386 aa     Download sequence    Send to blast
MGKGRAPCCD KTQVKRGPWS PAEDLKLIAF IQKYGHENWR ALPKQAGLLR CGKSCRLRWI  60
NYLRPDVKRG NFTLEEEENI IRLHKALGNK WSKIASRLPG RTDNEIKNVW NTHLKKRLAP  120
KKGSESSADE SKPESSITSA SSSSSESFFS YERPNSPKTT TPCNNDQFND QAEKLSIEDK  180
MEQDSEKQVS NELANITEDP KGSSVSLSSD ESNIVNTSQI VEHKPEEEQL ASPLPYLGHY  240
DVGSMLEEVD KPNQLIEIPW EPDYDFWKLL DDDNSLESFQ SNEVQLGEFP AIQNIILGEE  300
SVHDAEAKKW SQDFENEFGV VGEMKESNKD HFLPKNYAVE PEMDHTQAFD FDDIDMARPE  360
SELDLGYIQL WSSWPQNNNN NNNNSL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-26161187108B-MYB
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00249DAPTransfer from AT1G79180Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003532930.10.0PREDICTED: myb-related protein Myb4-like
TrEMBLA0A0B2R4T50.0A0A0B2R4T5_GLYSO; Myb-related protein Zm1
TrEMBLK7L7680.0K7L768_SOYBN; Uncharacterized protein
STRINGGLYMA08G17861.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF100293042
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G79180.14e-85myb domain protein 63
Publications ? help Back to Top
  1. Qi X, et al.
    Identification of a novel salt tolerance gene in wild soybean by whole-genome sequencing.
    Nat Commun, 2014. 5: p. 4340
    [PMID:25004933]